.
The Open Protein Structure Annotation Network
PDB Keyword
.

3igh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Uncharacterized Metal-Dependent Hydrolase from Pyrococcus Horikoshii. To be Published
    Site NYSGXRC
    PDB Id 3igh Target Id NYSGXRC-9564a
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS31598,14590967, PF07969 Molecular Weight 55604.35 Da.
    Residues 494 Isoelectric Point 6.42
    Sequence mgmkfiknlhvsklvidsmkalingtiytsfnplkkvsglvishgkviyagdsevakkivelsggeivd lkgkyvmpaffdshlhldelgmslemvdlrgaksieeliqrlkrgkgriifgfgwdqdelgewptrkel naidkpvfiyrkcfhvavandkmlellnltpskdfdedtgiikeksleearkvinervltvedyvyyik raqehlldlgvksvsfmsvnekalralfyleregklsinvfayvtpevldklesiglgrfqgnrltiag vklftdgslgartallskpysddpstsgqlvmereeliritekarslgldvaihaigdkaldvaldvfe ttgfpgriehaslvrddqlervknlkvrlsvqphfiisdwwivervgeervkwvyrfkdlmkvaelgfs tdspiepadpwltvdaavnrgkgkvklyeltkdqaldikdalhsytygsarvslasdigklepgfkaey iildrdplvvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.21234
    Matthews' coefficent 3.46 Rfactor 0.17812
    Waters 369 Solvent Content 64.47

    Ligand Information
    Ligands SO4 (SULFATE) x 19
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch