.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ij6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF AN UNCHARACTERIZED METAL-DEPENDENT HYDROLASE FROM Lactobacillus acidopphilus. To be Published
    Site NYSGXRC
    PDB Id 3ij6 Target Id NYSGXRC-9632a
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS31601,58337341, PF04909 Molecular Weight 34337.48 Da.
    Residues 304 Isoelectric Point 5.43
    Sequence mttkidayahilpakyyqkmlsvepnipnmfpfikiktlmdlderltkwpdqntkqvislanispedft dsktsaelcqsaneelsnlvdqhpgkfagavailpmnniesackvissikddenlvgaqiftrhlgksi adkefrpvlaqaaklhvplwmhpvfdarkpdnnlvfsweyelsqamlqlvqsdlfqdypnlkilvhhag amvpffsgridhildekhaqdfkkfyvdtailgntpalqlaidyygidhvlfgtdapfavmpsgadqii tqaindltisdkdkqkifhdnyyslike
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.26812
    Matthews' coefficent 2.81 Rfactor 0.22062
    Waters 384 Solvent Content 56.22

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 4;ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch