.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ijd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Uncharacterized protein Cthe_2304 from Clostridium thermocellum binds two copies of 5-methyl-5,6,7,8-tetrahydrofolic acid. To be Published
    Site NYSGXRC
    PDB Id 3ijd Target Id NYSGXRC-11273a
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS31694,3.20.20.220, PF00496, ABN53506.1 Molecular Weight 35161.92 Da.
    Residues 306 Isoelectric Point 8.06
    Sequence mlkqkilnresgiitygitppkknnteekikeisqkhierisgldidglviydlqdekervseerpfpf ietidpqiysenylkdlkipkiiyrcvgkytpdefrrltrpvsgqdafsvfvgaasrnqsvllklsday kirqdvnpdlllggvaiperhmkntdehlriidkinkgckyfitqavynveaakdflsdyyyysknnnl kmvpiiftltpcgstktlefmkwlgisiprwlendlmncedilnksvslsksifnelmefclekgipig cniesvsvrkveieasialakdikyimkgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.265
    Matthews' coefficent 2.24 Rfactor 0.218
    Waters 110 Solvent Content 45.03

    Ligand Information
    Ligands C2F (5-METHYL-5,6,7,8-TETRAHYDROFOLIC) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch