.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ik4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF probable L-alanine-DL-glutamate epimerase from Herpetosiphon aurantiacus. To be Published
    Site NYSGXRC
    PDB Id 3ik4 Target Id NYSGXRC-9449b
    Molecular Characteristics
    Source Herpetosiphon aurantiacus
    Alias Ids TPS31564,YP_001543890.1, PF01188 Molecular Weight 36782.16 Da.
    Residues 356 Isoelectric Point 5.33
    Sequence mpttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaaie rlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffggvskqletdmtit agdevhaaasakailargiksikvktagvdvaydlarlraihqaaptaplivdgncgydveralafcaa ckaesipmvlfeqplpredwagmaqvtaqsgfavaadesarsahdvlriaregtasviniklmkagvae glkmiaiaqaaglglmiggmvesilamsfsanlaagnggfdfidldtplfiaehpfiggfaqtggtlql advaghgvnla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.27531
    Matthews' coefficent 2.06 Rfactor 0.21676
    Waters 237 Solvent Content 40.26

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals K (POTASSIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch