.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ilv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glutamine-dependent NAD(+) synthetase from Cytophaga hutchinsonii. To be Published
    Site NYSGXRC
    PDB Id 3ilv Target Id NYSGXRC-11244e
    Molecular Characteristics
    Source Cytophaga hutchinsonii
    Alias Ids TPS31685,YP_679015.1, PF02540, 3.40.50.620 Molecular Weight 71033.76 Da.
    Residues 626 Isoelectric Point 5.18
    Sequence mstiriggaavnqtpidwennvknildaieeaknanveilclpelcitgygcedlfltdwvaetaieyc feiaasctditvslglpmriagityncvclvengivkgfsakqflanegvhyetrwftawprnhtttfl yndvkypfgdvlynvkdarigfeicedawrtdrvgirhyekgatlvlnpsashfafgksairydlvigg serfdctyvyanllgneagrmiydgevliahkgkliqrndrlsfknvnliyadiatdsaetpetvltqd dlekefefweatslglfdymrksrskgfvlslsggadssacaimvaemirkglkelgltaflqksnmet lfdlpalqhlpfeeqakkitavflttayqstrnsgdetytsaktlaesigatfynwsvdeeieqykati envierpltwekdditlqniqargrapiiwmltnvkqallittsnrsegdvgyatmdgdtaggiapiag vdkdfirswlrwaeknrnqhglhivnklaptaelrpseytqtderdlmpydvlarierkaikerlspvq vytalltegpytknefkywvkkffrlwsinqwkrerlapsfhmddfnidprswyrfpilssgfakelndldqlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.268
    Matthews' coefficent 2.26 Rfactor 0.244
    Waters 208 Solvent Content 45.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ilv
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch