.
The Open Protein Structure Annotation Network
PDB Keyword
.

3imh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF GALACTOSE 1-EPIMERASE FROM Lactobacillus acidophilus. To be Published
    Site NYSGXRC
    PDB Id 3imh Target Id NYSGXRC-11271g
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS31693,2.70.98.10, PF01263, YP_194309.1 Molecular Weight 36821.26 Da.
    Residues 328 Isoelectric Point 5.29
    Sequence mktnfvkyerkdnkdlceitlendagmavkvlnygatlekvlldgenmilslnspedyskernflggtv griagrvragqwkhgneihqlplndgdnhihggigtdmhvwdfrpscdseharvdltlfdpdgnndypg nlklharyeldnennlhylleavsdkltifnlvnhtyfnlgeraedlnlqmnadyylpvdeaglpdrgm aevagtafdfrktkrigdalnsddsqiklrngldhpfilngnnpaallssnkhrlivktnapalvlyag nhfnhtgivnnigqydgitfeaqcppaegndlgqitllpfekfkrtvdwkfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.16996
    Matthews' coefficent 3.08 Rfactor 0.13991
    Waters 998 Solvent Content 60.13

    Ligand Information
    Ligands GOL (GLYCEROL) x 8
    Metals CL (CHLORIDE) x 3;MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch