.
The Open Protein Structure Annotation Network
PDB Keyword
.

3in1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Ribokinase in complex with ADP from E.coli. To be Published
    Site NYSGXRC
    PDB Id 3in1 Target Id NYSGXRC-11206a
    Related PDB Ids 3h49 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS27128,PF00294, AAC74842.1, 3.40.1190.20 Molecular Weight 34949.14 Da.
    Residues 322 Isoelectric Point 4.95
    Sequence makrnndmdnldvicigaaivdiplqpvsknifdvdsypleriamttggdaineatiisrlghrtalms rigkdaagqfildhcrkenidiqslkqdvsidtsinvglvtedgertfvtnrngslwklniddvdfarf sqakllslasifnsplldgkalteiftqakarqmiicadmikprlnetlddicealsyvdylfpnfaea klltgketldeiadcflacgvktvviktgkdgcfikrgdmtmkvpavagitaidtigagdnfasgfiaa llegknlrecarfanataaisvlsvgattgvknrklveqlleeyeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.266
    Matthews' coefficent 2.72 Rfactor 0.226
    Waters 195 Solvent Content 54.86

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3in1
    1. Comparative binding energy analysis for binding affinity and target selectivity prediction
    S Henrich, I Feierberg, T Wang - Proteins: Structure, , 2010 - Wiley Online Library
     
    2. Ribokinase family evolution and the role of conserved residues at the active site of the PfkB subfamily representative, Pfk-2 from Escherichia coli
    R Cabrera, J Babul, V Guix - Archives of biochemistry and biophysics, 2010 - Elsevier
     
    3. Jp170 subtilase variants
    A Svendsen, S Minning - EP Patent 2,163,616, 2010 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch