.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ioy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative short-chain dehydrogenase (Saro_0793) from Novosphingobium aromaticivorans. To be published
    Site NYSGXRC
    PDB Id 3ioy Target Id NYSGXRC-11161b
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS31636,3.40.50.720, YP_496072.1 Molecular Weight 33857.57 Da.
    Residues 310 Isoelectric Point 5.20
    Sequence mkdfagrtafvtggangvgiglvrqllnqgckvaiadirqdsidkalatleaegsgpevmgvqldvasr egfkmaadevearfgpvsilcnnagvnlfqpieessyddwdwllgvnlhgvvngvttfvprmvervkag eqkgghvvntasmaaflaagspgiynttkfavrglseslhysllkyeigvsvlcpglvksyiyasddir pdalkgemkpvdktaverlagvhefgmepdvigarvieamkanrlhifshpdhkeelreifdeiiaeyq dypkdpgydqrvafekfradsfaearrqsraadf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23346
    Matthews' coefficent 2.31 Rfactor 0.20082
    Waters 56 Solvent Content 46.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch