.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ip3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative oxidoreductase (TM_0425) from Thermotoga maritima. To be Published
    Site NYSGXRC
    PDB Id 3ip3 Target Id NYSGXRC-11127e
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS31626,3.40.50.720, AAD35510.1 Molecular Weight 37401.21 Da.
    Residues 328 Isoelectric Point 6.62
    Sequence mlkicvigssghfryalegldeecsitgiapgvpeedlsklekaisemnikpkkynnwwemlekekpdi lvintvfslngkillealerkihafvekpiattfedlekirsvyqkvrnevfftamfgiryrphfltak klvsegavgeirlvntqksyklgqrpdfykkretyggtipwvgihaidwihwitgkkflsvyathsrlh nsghgelettalchftlenevfaslsidylrpqgapthdddrmrivgtrgivevinervfltdekghre vplvekgqifedflreirgqgkcmvtpedsiltteialkarlsadtgqivli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.14 Rfree 0.242
    Matthews' coefficent 2.55 Rfactor 0.204
    Waters 264 Solvent Content 51.83

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch