.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ipi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Geranyltranstransferase from the Methanosarcina mazei. To be Published
    Site NYSGXRC
    PDB Id 3ipi Target Id NYSGXRC-11257e
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS31692,1.10.600.10, NP_632813.1, PF00348 Molecular Weight 32744.77 Da.
    Residues 295 Isoelectric Point 4.94
    Sequence mpvkvhgvilmnieeweeyryveagikesitliedpglkkmvehvchsggkrirpiilllvseicsgsy srslnaalavemmhsaslihddlldqglvrrnlpsapekfgpsgallcgdyliaksiafispygekviq dfgkagmdmaegevldlkledesfgendyfkciykktaslfaisasigaytggaeeelaerfshfgnal gtayqivddileflevvegkeskftsetlphiymkstskeealkksidcvklhvaaaketletfrecpa rdklfqitdyitvdmlenl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.251
    Matthews' coefficent 2.07 Rfactor 0.214
    Waters 87 Solvent Content 40.48

    Ligand Information
    Ligands MLA (MALONIC) x 6
    Metals

    Jmol

     
    Google Scholar output for 3ipi
    1. Connected cavity structure enables prenyl elongation across the dimer interface in mutated geranylfarnesyl diphosphate synthase from Methanosarcina mazei
    T Ogawa, T Yoshimura, H Hemmi - Biochemical and Biophysical Research , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch