.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ipl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of o-succinylbenzoic acid-CoA ligase from Staphylococcus aureus. To be Published
    Site NYSGXRC
    PDB Id 3ipl Target Id NYSGXRC-11192i
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS31644,3.30.300.30, BAB57959.1, PF00501 Molecular Weight 55354.32 Da.
    Residues 492 Isoelectric Point 5.73
    Sequence mdfwlykqaqqnghhiaitdgqesytyqnlyceasllakrlkayqqsrvglyidnsiqsiilihacwla nieiamintrltpnemtnqmrsidvqlifctlplelrgfqivslddiefagrdittnglldntmgiqyd tsnetvvpkespsnilntsfnlddiasimftsgttgpqkavpqtfrnhyasaigckeslgfdrdtnwls vlpiyhisglsvllraviegftvrivdkfnaeqiltmiknerithislvpqtlnwlmqqglhepynlqk illggaklsatmietalqynlpiynsfgmtetcsqfltatpemlharpdtvgmpsanvdvkiknpnkeg hgelmikganvmngylyptdltgtfengyfntgdiaeidhegyvmiydrrkdliisggeniypyqietv akqfpgisdavcvghpddtwgqvpklyfvsesdiskaqliaylskhlakykvpkhfekvdtlpytstgk lqrnklyrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.24146
    Matthews' coefficent 2.18 Rfactor 0.18456
    Waters 417 Solvent Content 43.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ipl
    1. Structural and Functional Studies of Fatty Acyl Adenylate Ligases from E. coli and L. pneumophila
    Z Zhang, R Zhou, JM Sauder, PJ Tonge - Journal of Molecular , 2011 - Elsevier
     
    2. Stable Analogues of OSB_AMP: Potent Inhibitors of MenE, the o_Succinylbenzoate_CoA Synthetase from Bacterial Menaquinone Biosynthesis
    X Lu, R Zhou, I Sharma, X Li, G Kumar - , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch