The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Ribokinase (II)in complex with ATP and Mg+2 from E.coli. To be Published
    Site NYSGXRC
    PDB Id 3iq0 Target Id NYSGXRC-11206g
    Related PDB Ids 3k9e 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS31658,PF00294, AAN82454.1, 3.40.1190.20 Molecular Weight 34829.79 Da.
    Residues 320 Isoelectric Point 5.19
    Sequence mskvftigeilveimaskigqpfdqpgiwngpypsgapaifidqvtrlgvpcgiiscvgndgfgdinih rlaadgvdirgisvlpleatgsafvtyhnsgdrdfifniknaacgklsaqhvdenilkdcthfhimgss lfsfhmvdavkkavtivkanggvisfdpnirkemldipemrdalhfvleltdiympsegevlllsphst peraiagfleegvkevivkrgnqgasyysaneqfhvesypveevdptgagdcfggawiacrqlgfdahr alqyanacgalavtrrgpmegtsrlmeietfiqrhdmsireaaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.79 Rfree 0.255
    Matthews' coefficent 2.12 Rfactor 0.228
    Waters 261 Solvent Content 41.99

    Ligand Information
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch