.
The Open Protein Structure Annotation Network
PDB Keyword
.

3irv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF CYSTEINE HYDROLASE PSPPH_2384 FROM Pseudomonas syringae. To be Published
    Site NYSGXRC
    PDB Id 3irv Target Id NYSGXRC-11302b
    Molecular Characteristics
    Source Pseudomonas syringae pv. phaseolicola
    Alias Ids TPS31701,PF00857, 3.40.50.850, AAZ37838.1 Molecular Weight 28033.60 Da.
    Residues 252 Isoelectric Point 5.23
    Sequence vfngwlfrrelichmehdyclpcptslsgiaevnpmskplvrwpinplrtavivvdmqkvfceptgaly vkstadivqpiqkllqaaraaqvmviylrhivrgdgsdtgrmrdlypnvdqilarhdpdveviealapq sddvivdklfysgfhntdldtvlrardvdtiivcgtvtnvccettirdgvhreykvialsdanaamdyp dvgfgavsaadvqrislttiayefgevtttaevirriesayphgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.18955
    Matthews' coefficent 2.28 Rfactor 0.15933
    Waters 277 Solvent Content 46.04

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3irv
    1. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch