.
The Open Protein Structure Annotation Network
PDB Keyword
.

3isa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF enoyl-CoA hydratase FROM Bordetella parapertussis. To be Published
    Site NYSGXRC
    PDB Id 3isa Target Id NYSGXRC-11251l
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS31690,3.90.226.10, NP_886243.1, PF00378 Molecular Weight 26648.72 Da.
    Residues 247 Isoelectric Point 6.49
    Sequence lsamsaslplaierrpaawtftlsrpekrnalsaelvealidgvdaahreqvpllvfagagrnfsagfd ftdyetqsegdlllrmvriemllqrvagspsltlalahgrnfgagvdlfaackwryctpeagfrmpglk fglvlgtrrfrdivgadqalsilgsarafdadearrigfvrdcaaqaqwpalidaaaeaataldpatra tlhrvlrddhddadlaalarsaaqpgfkarirdylaqpaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.76 Rfree 0.20831
    Matthews' coefficent 2.75 Rfactor 0.16550
    Waters 1719 Solvent Content 55.35

    Ligand Information
    Ligands GOL (GLYCEROL) x 13
    Metals CL (CHLORIDE) x 43

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch