.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ivd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative 5'-Nucleotidase (c4898) from Escherichia Coli in complex with Uridine. To be Published
    Site NYSGXRC
    PDB Id 3ivd Target Id NYSGXRC-13565a
    Related PDB Ids 3ive 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS31549,PF00149, AAN83326.1 Molecular Weight 56766.84 Da.
    Residues 519 Isoelectric Point 6.50
    Sequence lfmkikilaagialtlpfwacakdvtiiytndlhahvepykvpwiadgkrdiggwanittlvkqekakn katwffdagdyftgpyissltkgkaiidimntmpfdavtignhefdhgwdntllqlsqakfpivqgnif yqnssksfwdkpytiiekdgvkigviglhgvfafndtvsaatrvgieardeikwlqryidelkgkvdlt valihegvparqssmggtdvrraldkdiqtasqvkgldilitghahvgtpepikvgntlilstdsggid vgklvldykekphnftvknfelktiyadewkpdqqtkqvidgwnkkldevvqqtvaqspvelkrayges aslgnlaadallaaagkntqlaltnsggirneipagaitmggvistfpfpnelvtmeltgkqlrslmeh gaslsngvlqvskglemkydsskpvgqrvitltlngkpiedatvyhiatqsfladggdgftaftegkar nitggyyvyhavvdyfkagntitdeqlngmrvkdik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.210
    Matthews' coefficent 2.30 Rfactor 0.167
    Waters 460 Solvent Content 46.62

    Ligand Information
    Ligands URI (URIDINE) x 2
    Metals CL (CHLORIDE) x 2;FE (FE) x 2;MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 3ivd
    1. Cellular function and molecular structure of ecto-nucleotidases
    H Zimmermann, M Zebisch, N Strter - Purinergic signalling, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch