.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ivr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF PUTATIVE long-chain-fatty-acid CoA SYNTHASE FROM Rhodopseudomonas palustris CGA009. To be Published
    Site NYSGXRC
    PDB Id 3ivr Target Id NYSGXRC-11192l
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS31645,CAE26685.1, 3.30.300.30, PF00501 Molecular Weight 53399.92 Da.
    Residues 503 Isoelectric Point 5.68
    Sequence mmalhdftladvyrrnaalfpdrtafmvdgvrlthrdylaraerlasgllrdgvhtgdrvailsqncse mieligavaligaillpvnyrlnadeiafvlgdgapsvvvagtdyrdivagvlpslggvkkayaigdgs gpfapfkdlasdtpfsapefgaadgfviihtaavggrprgalisqgnlliaqsslvdawrlteadvnlg mlplfhvtglglmltlqqaggasviaakfdpaqaardieahkvtvmaefapmlgnildqaapaqlaslr avtgldtpetierfeatcpnatfwatfgqsetsglstfapyrdrpksagrplfwrtvavvdaedrplpp gevgeivlrgptvfkgywnnaaatqhafrngwhhtgdmgrfdadgylfyagrapekeliktggenvypa evegalkqhpaiadavvigvpdpqwseaikavcvckpgesiaadalaefvasliarykkpkhvvfveal pkdakgaidraavktahgqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21737
    Matthews' coefficent 2.67 Rfactor 0.17260
    Waters 426 Solvent Content 53.89

    Ligand Information
    Ligands GOL (GLYCEROL) x 6
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch