.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iwa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a FAD-dependent pyridine nucleotide-disulphide oxidoreductase from Desulfovibrio vulgaris. To be Published
    Site NYSGXRC
    PDB Id 3iwa Target Id NYSGXRC-11146g
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS31633,3.40.50.720, YP_012422.1 Molecular Weight 61120.44 Da.
    Residues 569 Isoelectric Point 5.09
    Sequence mpkhvvvigavalgpkaacrfkrldpeahvtmidqasrisyggcgipyyvsgevsnieslqatpynvvr dpeffrinkdvealvetrahaidraahtveienlrtgerrtlkydklvlalgskanrppvegmdlagvt pvtnldeaefvqhaisagevskavivgggfiglemavsladmwgidttvveladqimpgftskslsqml rhdlekndvvvhtgekvvrlegengkvarvitdkrtldadlvilaagvspntqlardagleldprgaii vdtrmrtsdpdifaggdcvtipnlvtgkpgffplgsmanrqgrvigtnladgdatfpgavgswavklfe gsasgagltvegalregydavnvhveqfdrahfypektimtlqlvvdrptrrvlgiqgfstlgdaltar inavatmlaskptvedisnaevvysppfasamdivnvagnvadnvlagrcrlvgteefvqlwegrkdad icfvdtrlaanavplvekygdewinipeeelaarideiprdktvmlvcntglrsfesqlildrlgltnt ksvaggmvaihkiggdi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.243
    Matthews' coefficent 2.44 Rfactor 0.208
    Waters 48 Solvent Content 49.64

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch