.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jte

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator receiver domain Protein from clostridium thermocellum. To be Published
    Site NYSGXRC
    PDB Id 3jte Target Id NYSGXRC-11226e
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS31676,3.40.50.2300, ABN51819.1, PF00072 Molecular Weight 43884.06 Da.
    Residues 394 Isoelectric Point 4.81
    Sequence makilviddestilqnikflleidgnevltasssteglriftencnsidvvitdmkmpklsgmdilrei kkitphmaviiltghgdldnailamkegafeylrkpvtaqdlsiainnainrkkllmenermtqellah rnylqglhdsaakillnmlpknlpdiegfnfavdykscdgvggdmydvcdigdyicfyvfdvshhgila avisiiiksflqnieynyrqginkrrfpeivldlnlellsntaqnvfaslflgfidknskklytvsagh ipqyimkenglvplestgpilgvfedstykcavnqlepgdkvllftdgiiespsdssdessdgnqifgy enmvkvlescknepisttidkimkavkdfsgnrctddmtilgvevlken
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.248
    Matthews' coefficent 3.29 Rfactor 0.226
    Waters 63 Solvent Content 62.65

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch