.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative BenF-like porin from Pseudomonas fluorescens Pf-5. To be Published
    Site NYSGXRC
    PDB Id 3jty Target Id NYSGXRC-10383p
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS31713,BIG_265, Q4KH25_PSEF5 Molecular Weight 46223.22 Da.
    Residues 420 Isoelectric Point 7.79
    Sequence mkpstppsyllpsllalalsstalpalaaesgfledaqanltlrnfyfnrnftnptkaqgkaeewtqsf ildaksgftqgtvgfgmdvlglyslkldggkgtggtqllpldhdgrpadnfgrlgvafkarlsqtevkv gewmpvlpilrsddgrslpqtfrggqitskeiagltlyggqfransprddssmsdmsmfgkaaftsdrf nfqgaeyafndkrtqialwnaqlkdiysqqfinlihsqplgdwtlganlgffygkedgsaragdmenrt wsglfsakyggntfyvglqkltgdsawmrvngtsggtlandsynasydnakekswqvrhdynfaalgvp gltlmnryisgsnvhtatvsdgkewgresevaytvqsgtlknlnlkwrnstmrrdfsnnefdenrliis yplsll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.58 Rfree 0.275
    Matthews' coefficent 3.04 Rfactor 0.220
    Waters 25 Solvent Content 59.59

    Ligand Information
    Ligands LDA (LAURYL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3jty
    1. Energy-based classification and structure prediction of transmembrane beta-barrel proteins
    P Chassignet, S Sheikh - Advances in Bio and , 2011 - ieeexplore.ieee.org
     
    2. Structure of a putative BenF_like porin from Pseudomonas fluorescens Pf_5 at 2.6 resolution
    P Sampathkumar, F Lu, X Zhao, Z Li - Proteins: Structure, , 2010 - Wiley Online Library
     
    3. A knowledge_based potential highlights unique features of membrane __helical and __barrel protein insertion and folding
    D Hsieh, A Davis, V Nanda - Protein Science, 2012 - Wiley Online Library
     
    4. Structure of a putative BenF-like porin from Pseudomonas fluorescens Pf-5 at 2.6 resolution
    S Parthasarathy, F Lu, X Zhao, Z Li, J Gilmore, K Bain - Proteins, 2010 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch