.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jul

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Listeria innocua D-Tagatose-6-Phosphate Kinase bound with substrate. To be Published
    Site NYSGXRC
    PDB Id 3jul Target Id NYSGXRC-11206n
    Related PDB Ids 3ie7 3hic 
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS28248,CAC97428.1, PF00294, 3.40.1190.20 Molecular Weight 33751.96 Da.
    Residues 310 Isoelectric Point 5.68
    Sequence miytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiagsdnldkly ailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnllkqiakkvkkedmvvia gsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgvdfikpnedeviaildektnsleenir tlaekipylvvslgakgsicahngklyqvippkvqerndtgagdvfvgafiaglamnmpitetlkvatg csaskvmqqdsssfdleaagklknqvsiiqleer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.267
    Matthews' coefficent 2.02 Rfactor 0.226
    Waters 80 Solvent Content 39.10

    Ligand Information
    Ligands TA6 (6-O-PHOSPHONO-BETA-D-TAGATOFURANOSE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch