.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jvd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LACI family protein from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3jvd Target Id NYSGXRC-11235l
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS31679,3.40.50.2300, PF00532, YP_226284.1 Molecular Weight 34862.74 Da.
    Residues 327 Isoelectric Point 4.89
    Sequence vemsaksslkevaelagvgyatasralsgkgyvspqtrekvqaaakelnyvpnqlakalrehrsalvgv ivpdlsneyyseslqtiqqdlkaagyqmlvaeansvqaqdvvmeslisiqaagiihvpvvgsiapegip mvqltrgelgpgfprvlcddeagffqltesvlggsgmniaalvgeeslsttqermrgishaasiygaev tfhfghysvesgeemaqvvfnnglpdalivasprlmagvmraftrlnvrvphdvviggyddpewysfvg agittfvppheemgkeavrllvdlienpelptgdvvlqgqvilrgssthsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.28353
    Matthews' coefficent 2.45 Rfactor 0.22425
    Waters 74 Solvent Content 49.82

    Ligand Information
    Ligands SO4 (SULFATE) x 3;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch