.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Ribulokinase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 3jvp Target Id NYSGXRC-11199j
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS31647,PF00370, NP_242738.1, 3.30.420.40 Molecular Weight 61665.09 Da.
    Residues 563 Isoelectric Point 5.34
    Sequence mttkytigvdygtesgravlidlsngqeladhvtpyrhgvidqylpntniklghewalqhpldyvevlt tsvpavmkesgvdaddvigigvdftactmlpvdeegqplcllaqykdnphswvklwkhhaaqdkanain emaekrgeaflpryggkissewmiakvwqildeaedvynrtdqfleatdwivsqmtgkivknsctagyk aiwhkregypsneffkaldprlehltttklrgdivplgeraggllpemaekmglnpgiavavgnvdaha avpavgvttpgklvmamgtsichmllgekeqevegmcgvvedgiipgylgyeagqsavgdifawfvkhg vsaatfdeaqekgvnvhalleekasqlrpgesgllaldwwngnrsilvdtelsgmllgytlqtkpeeiy ralleatafgtraivdafhgrgvevhelyacgglpqknhllmqifadvtnreikvaaskqtpalgaamf asvaagsevggydsieeaakkmgrvkdetfkpipehvaiyeklyqeyvtlhdyfgrgandvmkrlkalk siqhrpssllt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.31 Rfree 0.278
    Matthews' coefficent 2.31 Rfactor 0.227
    Waters 395 Solvent Content 46.66

    Ligand Information
    Ligands 5RP (RIBULOSE-5-PHOSPHATE) x 1;SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch