.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jzv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Rru_A2000 from Rhodospirillum rubrum: A cupin-2 domain. To be Published
    Site NYSGXRC
    PDB Id 3jzv Target Id NYSGXRC-9492b
    Molecular Characteristics
    Source Rhodospirillum rubrum atcc 11170
    Alias Ids TPS31596,PF07883, 83593335 Molecular Weight 17123.39 Da.
    Residues 156 Isoelectric Point 5.82
    Sequence msdsnddrpfrpfqsqyrwpgvdllaykeegsapfrsvtrqvlfsgngltgelryfevgpgghstlerh qhahgvmilkgrghamvgravsavapydlvtipgwswhqfrapadealgflcmvnaerdkpqlpteadl amlraddavaafldglag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.278
    Matthews' coefficent 3.45 Rfactor 0.225
    Waters 12 Solvent Content 64.31

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch