.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein A6V7T0 from Pseudomonas aeruginosa. To be published
    Site NYSGXRC
    PDB Id 3k12 Target Id NYSGXRC-11275d
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS31695,PF01042, 3.30.1330.40, YP_001349115.1 Molecular Weight 13346.46 Da.
    Residues 117 Isoelectric Point 5.56
    Sequence mhierfevvkrraemalhgntiyiggqvaddpsgdirdqtrqvlenidrllqsvgsdrgqvlsvrilla hredyaglnqvwdqwfpegraptracslaelidpqwrvemivvaarpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.49 Rfree 0.214
    Matthews' coefficent 2.11 Rfactor 0.188
    Waters 559 Solvent Content 41.69

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3k12
    1. Identification and characterization of phospholipase A2 from Trypanosoma brucei
    K Muhammad - 2009 - w210.ub.uni-tuebingen.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch