.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Lin0012 protein from Listeria innocua. To be Published
    Site NYSGXRC
    PDB Id 3k17 Target Id NYSGXRC-11277e
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31698,PF08544, 3.30.230.10, CAC95245.1 Molecular Weight 40075.84 Da.
    Residues 360 Isoelectric Point 5.87
    Sequence vlyqmknklqvkipgklyvageyavvesghtailtavnryitltledsernelwiphyenpvswpigge lkpdgehwtftaeainiattflksegieltpvkmvietelidqsgakyglgssaaatvavinalmtkfy peismlkkfklaalshlvvqgngscgdiascmyggwiayttfdqewvkhrlaykslewfmkepwpmlqi etleepvptfsvgwtgtpvstgklvsqihafkqedsknyqhfltrnneimkqiiqafhtkdeellyssi kenrrilqelgtkagvnietsllkeladsaenmggagkssgsgggdcgiafsktkelaeklvneweklg ikhlpfhtgrvqite
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.252
    Matthews' coefficent 2.72 Rfactor 0.223
    Waters 385 Solvent Content 54.76

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3k17
    1. Linking genotype and phenotype of Saccharomyces cerevisiae strains reveals metabolic engineering targets and leads to triterpene hyper-producers
    KM Madsen, GD Udatha, S Semba, JM Otero, P Koetter - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch