.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k2g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Resiniferatoxin-binding protein from Rhodobacter sphaeroides. To be Published
    Site NYSGXRC
    PDB Id 3k2g Target Id NYSGXRC-9588c
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS31599,77390116, PF02126 Molecular Weight 39096.35 Da.
    Residues 354 Isoelectric Point 5.16
    Sequence mselspchvrsgrimtvdgpipssalghtlmhehlqndcrcwwnppqeperqylaeapisieilselrq dpfvnkhnialddldlaiaevkqfaavggrsivdptcrgigrdpvklrrisaetgvqvvmgagyylass mpetaarlsaddiadeivaealegtdgtdarigligeigvssdftaeeekslrgaaraqvrtglplmvh lpgwfrlahrvldlveeegadlrhtvlchmnpshmdpvyqatlaqrgaflefdmigmdffyadqgvqcp sddevarailgladhgyldrillshdvfvkmmltryggngyafvtkhflprlrrhglddaaletlmvtn prrvfdasi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.225
    Matthews' coefficent 2.33 Rfactor 0.204
    Waters 872 Solvent Content 47.24

    Ligand Information
    Ligands DTV ((2S,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL) x 4
    Metals ZN (ZINC) x 8;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3k2g
    1. What we have learned from crystal structures of proteins to receptor function
    JL Reymond, R van Deursen, D Bertrand - Biochemical pharmacology, 2011 - Elsevier
     
    2. Reconstructing a missing link in the evolution of a recently diverged phosphotriesterase by active-site loop remodeling
    L Afriat-Jurnou, CJ Jackson, DS Tawfik - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch