.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k2w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF betaine-aldehyde dehydrogenase FROM Pseudoalteromonas atlantica. To be Published
    Site NYSGXRC
    PDB Id 3k2w Target Id NYSGXRC-9482d
    Molecular Characteristics
    Source Pseudoalteromonas atlantica t6c
    Alias Ids TPS31594,109898868, PF00171 Molecular Weight 52794.51 Da.
    Residues 487 Isoelectric Point 4.98
    Sequence mtvqdlhfknkvnfiggqyvpsnesdtidilspstgkvigeipagckadaenalevaqaaqkawaklta rtrqnmlrtfankirenkhilapmlvaeqgkllsvaemevdvtatfidygcdnaltiegdilpsdnqde kiyihkvprgvvvgitawnfplalagrkigpalitgntmvlkptqetplattelgriakeaglpdgvln vingtgsvvgqtlcespitkmitmtgstvagkqiyktsaeymtpvmlelggkapmvvmddadldkaaed alwgrfancgqvctcverlyvhasvydefmakflplvkglkvgdpmdadsqmgpkcnqreidnidhivh eaikqgatvatggktatvegfeggcwyeptvlvdvkqdnivvheetfgpilpivkvssmeqaiefcnds iyglsayvhtqsfaninqaisdlevgevyinrgmgeqhqgfhngwkqsgfggedgkfgleqylekktvyinea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.90 Rfree 0.274
    Matthews' coefficent 2.34 Rfactor 0.210
    Waters 1612 Solvent Content 47.50

    Ligand Information
    Ligands GOL (GLYCEROL) x 17;ACT (ACETATE) x 6
    Metals CL (CHLORIDE) x 8

    Jmol

     
    Google Scholar output for 3k2w
    1. Crystallographic evidence for active-site dynamics in the hydrolytic aldehyde dehydrogenases. Implications for the deacylation step of the catalyzed reaction
    RA Muoz-Clares, L Gonzlez-Segura - Chemico-biological , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch