.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k4i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF uncharacterized protein PSPTO_3204 from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site NYSGXRC
    PDB Id 3k4i Target Id NYSGXRC-11306a
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato
    Alias Ids TPS31704,3.50.30.40, PF03737, AAO56687.1 Molecular Weight 25357.20 Da.
    Residues 237 Isoelectric Point 4.68
    Sequence msvpfeytpiaqsvldecehldtaslsdaldslgidgglpgiasqvpgtrcvgiaftvqyqpvdasegf rgaanyidqvpsgsvivssnsgrhdctvwgdimthfalangikgtvidgvardidtvincnyplfsrgr fmqsaknrtqlkavqvplvidgitiqpgdlmvcdgsgcvvvpqqlaaevvlraraveqterriieaiss gstleqarmtyrydqpwlseaehggtqvps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.69 Rfree 0.214
    Matthews' coefficent Rfactor 0.178
    Waters 374 Solvent Content

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3;CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch