.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Carbohydrate kinase (YjeF family)from Helicobacter pylori. To be Published
    Site NYSGXRC
    PDB Id 3k5w Target Id NYSGXRC-11206b
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS31655,PF01256, 3.40.1190.20, AAD08403.1 Molecular Weight 50734.24 Da.
    Residues 466 Isoelectric Point 6.57
    Sequence mlsvyekvnaldkraieelflsedilmenaamaleravlqnaslgakviilcgsgdnggdgyalarrlv grfktlvfemklakspmcqlqqerakkagvvikayeenalnqnlecdvlidcvigshfkgklepflnfe slsqkarfkiacdipsgidskgrvdkgafkadltismgaikscllsdrakdyvgelkvghlgvfnqiye iptdtflleksdlklplrdrknahkgdyghahvllgkhsgagllsalsalsfgsgvvsvqaleceitsn nkplelvfcenfpnllsafalgmglenipkdfnkwlelapcvldagvfyhkevlqalekeviltphpke flsllklvginismlelldnkleiardfsqkypkvvlllkgantliahqgqvfinilgsvalakagsgd vlaglilsllsqnytpldaainassahalaslefknnyaltpldliekikql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.262
    Matthews' coefficent 2.78 Rfactor 0.233
    Waters 79 Solvent Content 55.81

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3k5w
    1. Identification of Unknown Protein Function Using Metabolite Cocktail Screening
    IA Shumilin, M Cymborowski, O Chertihin, KN Jha - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch