.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a D-glycero-D-manno-heptose 1-phosphate kinase from Bacteriodes thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3k85 Target Id NYSGXRC-11277b
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS31697,3.30.230.10, AAO75581.1, PF00288 Molecular Weight 38081.52 Da.
    Residues 348 Isoelectric Point 5.91
    Sequence mivrskaplrlglagggsdvspysdiygglilnatinlyayctieetnsgrieinaydaqccksylsms qleidgeaslikgvynriirdyrlepksfkittyndapagsglgtsstmvvcilkafiewlslplgdye tsrlayeierkdlglsggkqdqyaaafggfnymeflqndlvivnplkmkrwivdelessmvlyftgrsr ssaaiineqkkntsegnqtaieamhkikqsaidtklallkgdvgefarilgegwenkkkmagaitnpmi qeafdvatgagamagkvsgaggggfimfvveptrkeevvralnnlngfvmpfqfiddgahgwkiystdkvqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.28 Rfree 0.282
    Matthews' coefficent 2.38 Rfactor 0.254
    Waters 137 Solvent Content 48.35

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch