.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k9c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LacI Transcriptional regulator from Rhodococcus species. To be Published
    Site NYSGXRC
    PDB Id 3k9c Target Id NYSGXRC-11026w
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS31617,Q0S5Y9_RHOSR, 3.40.50.2300, PF00532 Molecular Weight 35502.26 Da.
    Residues 341 Isoelectric Point 5.70
    Sequence vvepvagstggarptmgdvaraagvstalvsivmrgvpgaseatrrrvldiademgyvpdrraqklrqa ssrllgvvfelqqpfhgdlveqiyaaatrrgydvmlsavapsraekvavqalmrerceaaillgtrfdt delgaladrvpalvvarasglpgvgavrgddvagitlavdhltelghrniahidgadapggadrragfl aamdrhglsasatvvtggttetegaegmhtllemptpptavvafndrcatgvldllvrsgrdvpadisv vgyddsrlariphvqmttisqdathmaeaavdgalaqisgdkavdlvlaphlvrrattgpvahrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.14 Rfree 0.243
    Matthews' coefficent 2.14 Rfactor 0.209
    Waters 240 Solvent Content 42.43

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3k9c
    1. Architecture of the catalytic HPN motif is conserved in all E2 conjugating enzymes
    WC Benjamin, SS Gary - Biochemical Journal, 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch