.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k9d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Aldehyde Dehydrogenase from Listeria Monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3k9d Target Id NYSGXRC-13591a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS31552,AAT03965.1, PF00171 Molecular Weight 51895.91 Da.
    Residues 486 Isoelectric Point 6.42
    Sequence valedkdlrsiqevrnliesankaqkelaamsqqqidtivkaiadagygareklakmaheetgfgiwqd kviknvfaskhvynyikdmktigmlkednekkvmevavplgvvaglipstnptstviyktlisikagns ivfsphpnalkailetvriiseaaekagcpkgaiscmtvptiqgtdqlmkhkdtavilatggsamvkaa yssgtpaigvgpgngpafiersanipravkhildsktfdngticaseqsvvvervnkeaviaefrkqga hflsdaeavqlgkfilrpngsmnpaivgksvqhianlagltvpadarvliaeetkvgakipysreklap ilafytaetwqeacelsmdilyhegaghtliihsedkeiirefalkkpvsrllvntpgalggigattnl vpaltlgcgavggssssdnigpenlfnirriatgvleledirkeenqatselpvdadaliqslvekvlaelk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.29237
    Matthews' coefficent 2.64 Rfactor 0.23912
    Waters 476 Solvent Content 53.46

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3k9d
    1. Crystallographic evidence for active-site dynamics in the hydrolytic aldehyde dehydrogenases. Implications for the deacylation step of the catalyzed reaction
    RA Muoz-Clares, L Gonzlez-Segura - Chemico-biological , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch