.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kd9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pyridine nucleotide disulfide oxidoreductase from Pyrococcus horikoshii. To be Published
    Site NYSGXRC
    PDB Id 3kd9 Target Id NYSGXRC-11140o
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS31628,3.40.50.720, NP_142538.1 Molecular Weight 48974.18 Da.
    Residues 445 Isoelectric Point 6.02
    Sequence mgenmkkkvviigggaagmsaasrvkrlkpewdvkvfeatewvshapcgipyvveglstpdklmyyppe vfikkrgidlhlnaevievdtgyvrvrenggeksyewdylvfangaspqvpaiegvnlkgvftadlppd alaireymekykvenvviigggyigiemaeafaaqgknvtmivrgervlrrsfdkevtdileeklkkhv nlrlqeitmkiegeervekvvtdageykaelvilatgikpnielakqlgvrigetgaiwtnekmqtsve nvyaagdvaetrhvitgrrvwvplapagnkmgyvagsniagkelhfpgvlgtavtkfmdveigktglte mealkegydvrtafikastrphyypggreiwlkgvvdnetnrllgvqvvgsdilpridtaaamlmagft tkdafftdlayappfapvwdplivlarvlkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.75 Rfree 0.284
    Matthews' coefficent 3.92 Rfactor 0.244
    Waters 119 Solvent Content 68.65

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch