.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kes

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the autoproteolytic domain from the nuclear pore complex component NUP145 from Saccharomyces cerevisiae in the Hexagonal, P61 space group. To be Published
    Site NYSGXRC
    PDB Id 3kes Target Id NYSGXRC-15145a
    Related PDB Ids 3kep 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS31605,6321346, PF04096 Molecular Weight 145653.27 Da.
    Residues 1317 Isoelectric Point 5.55
    Sequence mfnksvnsgftfgnqntstptstpaqpssslqfpqkstglfgnvnvnantstpspsgglfnansnansi sqqpannslfgnkpaqpsgglfgatnnttsksagslfgnnnatanstgstglfsgsnniasstqngglf gnsnnnnitsttqngglfgkptttpagagglfgnssstnsttglfgsnntqsstgifgqkpgasttggl fgnngasfprsgettgtmstnpyginisnvpmavadmprsitsslsdvngksdaepkpienrrtysfss svsgnaplplasqsslvsrlstrlkatqkstspneifspsyskpwlngagsaplvddffsskmtslapn ensifpqngfnflssqradltelrklkidsnrsaakklkllsgtpaitkkhmqdeqdssenepianads vtnidrkenrdnnldntylngkeqsnnlnkqdgentlqheksssfgywcspspeqlerlslkqlaavsn fvigrrgygcitfqhdvdltaftksfreelfgkivifrssktvevypdeatkpmighglnvpaiitlen vypvdkktkkpmkdttkfaefqvfdrklrsmremnyisynpfggtwtfkvnhfsiwglvneedaeided dlskqedggeqplrkvrtlaqskpsdkevilktdgtfgtlsgkddsiveekayepdlsdadfegieasp kldvskdwveqlilagsslrsvfatskefdgpcqneidllfsecndeidnaklimkerrftasytfakf stgsmlltkdivgksgvsikrlptelqrkflfddvyldkeiekvtiearksnpypqisessllfkdald ymektssdynlwklssilfdpvsypyktdndqvkmallkkerhcrltswivsqigpeieekirnssnei eqiflylllndvvrasklaiesknghlsvlisylgsndprirdlaelqlqkwstggcsidkniskiykl lsgspfeglfslkelesefswlcllnltlcygqideysleslvqshldkfslpyddpigvifqlyaane nteklykevrqrtnaldvqfcwyliqtlrfngtrvfsketsdeatfafaaqlefaqlhghslfvscfln ddkaaedtikrlvmreitllrastndhilnrlkipsqlifnaqalkdryegnylsevqnlllgssydla emaivtslgprlllsnnpvqnnelktlreilnefpdserdkwsvsinvfevylklvldnvetqetidsl isgmkifydqykhcrevaaccnvmsqeivskileknnpsigdskakllelplgqpekaylrgefaqdlmkctyki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.230
    Matthews' coefficent 3.62 Rfactor 0.190
    Waters 161 Solvent Content 66.04

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 22
    Metals

    Jmol

     
    Google Scholar output for 3kes
    1. Structures of the autoproteolytic domain from the Saccharomyces cerevisiae nuclear pore complex component, Nup145
    P Sampathkumar, SA Ozyurt, J Do - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch