.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kew

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alanyl-trna-synthase from Clostridium perfringens. To be Published
    Site NYSGXRC
    PDB Id 3kew Target Id NYSGXRC-13658a
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS31555,ABG82719.1, PF07973 Molecular Weight 45290.54 Da.
    Residues 400 Isoelectric Point 6.16
    Sequence mtklyyedqyikefkgeiievkeidgkfhvlldqtaffpggggqmgdlglidgikvldvyeeegkvyhv lekepkklknlqceldwerrfdgmqqhlgqhllsgcfydlfgantcgfhlgkeistvdivgfldektir eaekeanrlifenlevksyapskkelkkvktrralpktdeeiriveivgldlnaccgvhprntrdlqvi kirrwekhknatrieyvagnravsdfftkdeilgeickllksgegdtlnavknllennknlvdenrkvk aeigdykikemlnkserigsitlvneifdgedtkhigklankiteeyeaivlfavkngdrvnlifnssk dmkkvnmsdilkdtitlidgrgggnqfaaqgggknngntevaidyatnkirnill
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.25935
    Matthews' coefficent 2.70 Rfactor 0.21870
    Waters 156 Solvent Content 54.70

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch