.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kfo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain from the nuclear pore complex component NUP133 from Saccharomyces cerevisiae. To be Published
    Site NYSGXRC
    PDB Id 3kfo Target Id NYSGXRC-15133a
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS31602,PF04044, 6322935 Molecular Weight 133313.52 Da.
    Residues 1157 Isoelectric Point 5.00
    Sequence msekkvhlrlrkelsvpiavveneslaqlsyeeesqaslmdismeqqqlrlhshfdnskvftennryiv ktlqtdyssgfsnddelngyidmqigyglvndhkkvyiwnihstqkdtpyitvpfrsddndeiavaprc iltfpatmdesplalnpndqdetggliiikgskaiyyedinsinnlnfklsekfshelelpinssggek cdlmlncepagivlstnmgriffitirnsmgkpqlklgkllnkpfklgiwskifntnssvvslrngpil gkgtrlvyittnkgifqtwqlsatnshptklidvniyeaileslqdlypfahgtlkiwdshplqdessq lflssiydsscnetyyilstiifdsssnsftifstyrlntfmesitdtkfkpkifipqmenandtnevt silvmfpnavvitqvnskldssysmrrkwedivslrndidiigsgydskslyvltkqmgvlqffvkene etnskpevgfvkshvdqavyfskinanpidfnlppeisldqesiehdlkltseeifhsngkyippmlnt lgqhlsvrkeffqnfltfvaknfnykispelkldliekfeilnccikfnsiirqsdvlndiwektlsny nltqnehlttktvvinspdvfpvifkqflnhvvfvlfpsqnqnfklnvtnlinlcfydgileegektir yelleldpmevdtsklpwfinfdylncinqcffdftfaceeegsldsykegllkivkilyyqfnqfkiw intqpvksvnandnfininnlyddnhldwnhvlckvnlkeqciqiaefykdlsglvqtlqtldqndstt vslyetffnefpkefsftlfeylikhkklndlifrfpqqhdvliqffqesapkyghvawiqqildgsya damntlknitvddskkgeslsecelhlnvaklssllvekdnldintlrkiqynldtidaeknisnklkk gevqickrfkngsirevfnilveelksttvvnlsdlvelysmlddeeslfiplrllsvdgnllnfevkk flnalvwrrivllnasnegdkllqhivkrvfdeelpknndfplpsvdllcdkslltpeyisetygrfpi dqnaireeiyeeisqvetlnsdnsleiklhstigsvakeknytinyetntvey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.245
    Matthews' coefficent Rfactor 0.191
    Waters 102 Solvent Content

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3kfo
    1. Modeling of proteins and their assemblies with the integrative modeling platform
    B Webb, K Lasker, D Schneidman-Duhovny - nuclear magnetic , 2011 - Springer
     
    2. Structure of the C_terminal domain of Saccharomyces cerevisiae Nup133, a component of the nuclear pore complex
    P Sampathkumar, T Gheyi, SA Miller - Proteins: Structure, , 2011 - Wiley Online Library
     
    3. Integrative structural modeling with small angle X-ray scattering profiles
    D Schneidman-Duhovny, SJ Kim - BMC Structural , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch