.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kfw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Uncharacterized protein Rv0674 from Mycobacterium tuberculosis. To be Published
    Site NYSGXRC
    PDB Id 3kfw Target Id NYSGXRC-13847b
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS31557,PF07848, CAA17457.1 Molecular Weight 26539.06 Da.
    Residues 240 Isoelectric Point 8.04
    Sequence mpamtarsvvlsvllgahpawataseliqltadfgikettlrvaltrmvgagdlvrsadgyrlsdrlla rqrrqdeamrprtrawhgnwhmlivtsigtdartraalrtcmhhkrfgelregvwmrpdnldldlesdv aarvrmltardeapadlagqlwdlsgwteaghrllgdmaaatdmpgrfvvaaamvrhlltdpmlpaell padwpgaglraayhdfatamakrrdatqllevt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.287
    Matthews' coefficent 2.61 Rfactor 0.230
    Waters Solvent Content 52.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kfw
    1. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     
    2. Crystallization and preliminary X-ray diffraction studies of the transcriptional repressor PaaX, the main regulator of the phenylacetic acid degradation pathway in
    A Rojas-Altuve, C Carrasco-Lpez - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch