.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Mannheimia succiniciproducens. To be Published
    Site NYSGXRC
    PDB Id 3kg4 Target Id NYSGXRC-10400h
    Molecular Characteristics
    Source Mannheimia succiniciproducens
    Alias Ids TPS31714,YP_088180, PF09704, BIG_185 Molecular Weight 25829.33 Da.
    Residues 225 Isoelectric Point 7.76
    Sequence manrirlhiwgdyacftrpemkvervsydvitpsaargilsaihwkpainwvidkiyvlkpirfesvrr nelgakiseskvsgamkrksvadlytvieddrqqraatvlkdvayvieahavmtskagvdenttkhiem fkrralkgqcfqqpcmgvrefpahfaliddndplplsqlsesefnrdlgwmlhdidfehgntphffrae lkngvidvppfyaeevkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.242
    Matthews' coefficent 2.21 Rfactor 0.211
    Waters 63 Solvent Content 44.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kg4
    1. Unification of Cas protein families and a simple scenario for the origin and evolution of CRISPR-Cas systems
    KS Makarova, L Aravind, YI Wolf, EV Koonin - Biology direct, 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch