.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kgz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a cupin 2 conserved barrel domain protein from Rhodopseudomonas palustris. To be Published
    Site NYSGXRC
    PDB Id 3kgz Target Id NYSGXRC-9491b
    Molecular Characteristics
    Source Rhodopseudomonas palustris tie-1
    Alias Ids TPS31595,PF07883, 167364620 Molecular Weight 18220.49 Da.
    Residues 165 Isoelectric Point 5.44
    Sequence mandnaaaphpaagervgvraqtapgrwdgvavmpykqtaeapfqdvsrqllfadpnlacewryfevde ggystlerhahvhavmihrghgqclvgetisdvaqgdlvfippmtwhqfranrgdclgflcvvnaardr pqlptaddlaelrkderiadfirtgge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.248
    Matthews' coefficent 2.31 Rfactor 0.199
    Waters 180 Solvent Content 46.80

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 3kgz
    1. Structural adaptation of extreme halophilic proteins through decrease of conserved hydrophobic contact surface
    A Siglioccolo, A Paiardini, M Piscitelli - BMC Structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch