.
The Open Protein Structure Annotation Network
PDB Keyword
.

3khk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of type-I restriction-modification system methylation subunit (MM_0429) from Methanosarchina mazei. To be Published
    Site NYSGXRC
    PDB Id 3khk Target Id NYSGXRC-11121d
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS31623,NP_632453.1, 3.40.50.150 Molecular Weight 66254.28 Da.
    Residues 576 Isoelectric Point 4.94
    Sequence midieqqflndldnqlwraadklrsnldaanykhvvlgliflkyvsdafeerqqeltelfqkddddniy ylpredydsdeayqqaiaeeleigdyyteknvfwvpktarwnklrdvitlptgsviwqdeqgedvklrs vswlidnafddiekanpklkgilnrisqyqldadkliglinefsltsfnnpeyngeklnlkskdilghv yeyflgqfalaegkqggqyytpksivtlivemlepykgrvydpamgsggffvssdkfiekhanvkhyna seqkkqisvygqesnpttwklaamnmvirgidfnfgkknadsflddqhpdlradfvmtnppfnmkdwwh ekladdprwtintngekriltpptgnanfawmlhmlyhlaptgsmalllangsmssntnnegeirktlv eqdlvecmvalpgqlftntqipaciwfltkdknakngkrdrrgqvlfidarklgymkdrvlrdfkdedi qkladtfhnwqqewseennqagfcfsadlalirkndfvltpgryvgaeaeeddgilfadkmavltsqlk eqfeesrkleaqikqnlaglgfdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.242
    Matthews' coefficent 2.33 Rfactor 0.213
    Waters 18 Solvent Content 47.15

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3khk
    1. Characterization and crystal structure of the type IIG restriction endonuclease RM. BpuSI
    BW Shen, D Xu, SH Chan, Y Zheng, Z Zhu - Nucleic acids , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch