.
The Open Protein Structure Annotation Network
PDB Keyword
.

3khn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative MotB like protein DVU_2228 from Desulfovibrio vulgaris. To be Published
    Site NYSGXRC
    PDB Id 3khn Target Id NYSGXRC-11276i
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS31696,3.30.1330.60, PF00691, YP_011441.1 Molecular Weight 27503.66 Da.
    Residues 244 Isoelectric Point 4.74
    Sequence vapgddeplfdveedeppnewmttlsdismlllaffillfslssidkkrfaesfetvrmvfggkeselt tsnvrtdegalletvrlqrelieaqrqtynemrtyftvngvegvigavfdegvitlrvpsevlfapgav elapgadrvlatlkdlfirrreqninikgftddvqpsanarfkdnwevsalrsvnvlryflgagiepar ltatglgeldplfpntsdenrarnrrvefvlerrvvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.03 Rfree 0.251
    Matthews' coefficent 1.91 Rfactor 0.185
    Waters 171 Solvent Content 35.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3khn
    1. Crystal structure of hypothetical protein TTHB210, controlled by the _E/anti__E regulatory system in Thermus thermophilus HB8, reveals a novel homodecamer
    Y Agari, S Kuramitsu, A Shinkai - Proteins: Structure, Function, , 2012 - Wiley Online Library
     
    2. Role of the MotB linker in the assembly and activation of the bacterial flagellar motor
    J O'Neill, M Xie, M Hijnen - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch