.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kht

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator from Hahella chejuensis. To be Published
    Site NYSGXRC
    PDB Id 3kht Target Id NYSGXRC-11023k
    Molecular Characteristics
    Source Hahella chejuensis
    Alias Ids TPS53395,Q2SI73_HAHCH, 3.40.50.2300, PF00072 Molecular Weight 16538.98 Da.
    Residues 148 Isoelectric Point 6.81
    Sequence masdrcrgdnivrskrvlvvednpddialirrvldrkdihcqlefvdngakalyqvqqakydliildig lpiangfevmsavrkpganqhtpiviltdnvsddrakqcmaagassvvdkssnnvtdfygriyaifsyw ltvnhcqlar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.288
    Matthews' coefficent 2.88 Rfactor 0.224
    Waters 74 Solvent Content 57.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch