The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3kjx Target Id NYSGXRC-11232m
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS31677,, PF00532, YP_168878.1 Molecular Weight 37363.95 Da.
    Residues 341 Isoelectric Point 5.45
    Sequence ltadtkrpltlrdvseasgvsemtvsrvlrnrgdvsdatrarvlaaakelgyvpnkiagalasnrvnlv aviipslsnmvfpevltginqvledtelqpvvgvtdylpekeekvlyemlswrpsgviiaglehseaar amldaagipvveimdsdgkpvdamvgishrragremaqailkagyrrigfmgtkmpldyrarkrfegft evlgkngveiedrefysggsalakgremtqamlerspdldflyysndmiaaggllylleqgidipgqig lagfnnvellqglprklatmdacrleigrkaaeiiakrledpeaeietritlepkisygdtlkrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.33 Rfree 0.287
    Matthews' coefficent 2.38 Rfactor 0.238
    Waters 124 Solvent Content 48.42

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch