.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kq5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Coxiella burnetii. To be Published
    Site NYSGXRC
    PDB Id 3kq5 Target Id NYSGXRC-10172e
    Molecular Characteristics
    Source Coxiella burnetii
    Alias Ids TPS31710,Q83DY0, PF07515 Molecular Weight 46422.97 Da.
    Residues 410 Isoelectric Point 6.57
    Sequence mfirsnhdqtsknqfykpgmlvpvfsaagllkngryqfllqqietlsllpteqyaqlyealvyrfvefv qvlpirldeplcslmnegllrgvnslnhyiqnhpeatpleryalfsaglllevahavvnqkifitdeeg nfikqwnpfsgpliddvetkhykimplssyyqrnipsitpilvrqllpdegflwltsdmrvfsdwmqal rddegegggrfehvlqlfkhknidglfntlpalpvnlqdspatahadaflnwlkealatnqikvntsda gvhvipegvflektgifkqyidlhvnvpvnlftvyqqfgnlfgltklsgidyrfeqlfseypdalkrks kmgfagligirrasptregvliadpnliftrgeipsatsylklssaqksqnipmtptssvkpkik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.221
    Matthews' coefficent 2.17 Rfactor 0.189
    Waters 91 Solvent Content 43.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch