.
The Open Protein Structure Annotation Network
PDB Keyword
.

3krt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative crotonyl CoA reductase from Streptomyces coelicolor A3(2). To be Published
    Site NYSGXRC
    PDB Id 3krt Target Id NYSGXRC-11151b
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS31635,3.40.50.720, NP_630556.1 Molecular Weight 49244.76 Da.
    Residues 447 Isoelectric Point 5.66
    Sequence vtvkdildaiqspdstpadiaalplpesyraitvhkdetemfagletrdkdprksihlddvpvpelgpg ealvavmassvnynsvwtsifeplstfgflerygrvsdlakrhdlpyhvigsdlagvvlrtgpgvnawq agdevvahclsvelessdghndtmldpeqriwgfetnfgglaeialvksnqlmpkpdhlsweeaaapgl vnstayrqlvsrngagmkqgdnvliwgasgglgsyatqfalagganpicvvsspqkaeicramgaeaii drnaegyrfwkdentqdpkewkrfgkrireltggedidivfehpgretfgasvfvtrkggtittcasts gymheydnrylwmslkriigshfanyreaweanrliakgrihptlskvysledtgqaaydvhrnlhqgk vgvlclapeeglgvrdrekraqhldainrfrni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.19 Rfree 0.238
    Matthews' coefficent 2.28 Rfactor 0.189
    Waters 458 Solvent Content 46.09

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch