.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ksm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ABC-type sugar transport system, periplasmic component from Hahella chejuensis. To be Published
    Site NYSGXRC
    PDB Id 3ksm Target Id NYSGXRC-11023l
    Molecular Characteristics
    Source Hahella chejuensis
    Alias Ids TPS31615,3.40.50.2300, PF00532, Q2S7D2_HAHCH Molecular Weight 34299.29 Da.
    Residues 318 Isoelectric Point 6.08
    Sequence mpsvlhspgavrrlsvcaallalvwliasplsqadihqpklllvlkgdsnaywrqvylgaqkaadeagv tllhrstkddgdiagqiqilsyhlsqappdalilapnsaedltpsvaqyrarnipvlvvdsdlagdahq glvatdnyaagqlaarallatldlskerniallrlragnastdqreqgfldvlrkhdkiriiaapyagd drgaarsemlrllketptidglftpnesttigalvairqsgmskqfgfigfdqteeleaamyageisnl vvqnpeymgylavqraldlvrgkpipaftdtgvrllqplpkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.20278
    Matthews' coefficent 2.30 Rfactor 0.16218
    Waters 349 Solvent Content 46.49

    Ligand Information
    Ligands BDR (BETA-D-RIBOFURANOSYL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ksm
    1. Structural basis for a ribofuranosyl binding protein: Insights into the furanose specific transport
    A Bagaria, D Kumaran, SK Burley - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch