The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Short-Chain Dehydrogenase from Oenococcus Oeni Psu-1. To be Published
    Site NYSGXRC
    PDB Id 3ksu Target Id NYSGXRC-11163m
    Molecular Characteristics
    Source Oenococcus oeni
    Alias Ids TPS31637,, YP_809745.1 Molecular Weight 27840.20 Da.
    Residues 252 Isoelectric Point 6.39
    Sequence mtkyhdlknkviviaggiknlgaltaktfalesvnlvlhyhqakdsdtanklkdeledqgakvalyqsd lsneeevaklfdfaekefgkvdiaintvgkvlkkpivetseaefdamdtinnkvayffikqaakhmnpn ghiitiatsllaaytgfystyagnkapvehytraaskelmkqqisvnaiapgpmdtsffygqetkesta fhksqamgnqltkiediapiikflttdgwwingqtifanggyttr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.286
    Matthews' coefficent 2.23 Rfactor 0.230
    Waters 86 Solvent Content 44.77

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch