.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ktn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a putative 2-Keto-3-deoxygluconate Kinase from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 3ktn Target Id NYSGXRC-11206j
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS31661,PF00294, AAO80652.1, 3.40.1190.20 Molecular Weight 38050.25 Da.
    Residues 336 Isoelectric Point 5.75
    Sequence mkiaafgevmlrftppeylmleqteqlrmnfvgtgvnllanlahfqletalitklpanrlgeagkaalr klgisdqwvgekgdhigsffaemgygirptqvtyqnrhqsafgiseakdydfeaflaevdmvhicgisl sltektrdaalilaqkahayqkkvcfdfnyrpslntansalfmrqqyerilpycdivfgsrrdlvellg fipredlegeaqeteliqrfmsqynlewfagttrshsqnqnylsgylytqneyqqsekrpllnldriga gdayaagilygysqnwslekavtfatvngvlahtiqgdiplttvkqvnhvlehpnidlir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.26 Rfree 0.238
    Matthews' coefficent 4.87 Rfactor 0.223
    Waters 163 Solvent Content 74.75

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3ktn
    1. The statistical mechanics of free and protein-bound DNA by Monte Carlo simulation
    L Czapla - 2009 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch