The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NYSGXRC
    PDB Id 3kts Target Id NYSGXRC-13910a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS31562,AAT04199.1, PF04309 Molecular Weight 20039.47 Da.
    Residues 182 Isoelectric Point 6.65
    Sequence lelpfsnqsiipaahnqkdmekileldltymvmlethvaqlkalvkyaqaggkkvllhadlvnglkndd yaidflcteicpdgiistrgnaimkakqhkmlaiqrlfmidssaynkgvaliqkvqpdciellpgiipe qvqkmtqklhipviagglietseqvnqviasgaiavttsnkhlw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.75 Rfree 0.27150
    Matthews' coefficent 2.64 Rfactor 0.21786
    Waters 2 Solvent Content 53.41

    Ligand Information
    Ligands UNL (UNKNOWN) x 8



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch