.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kzh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative sugar kinase from Clostridium perfringens. To be Published
    Site NYSGXRC
    PDB Id 3kzh Target Id NYSGXRC-11209e
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS31664,PF00294, YP_696169.1, 3.40.1190.20 Molecular Weight 35686.75 Da.
    Residues 321 Isoelectric Point 5.05
    Sequence mnlrkepyllvfgasvvdvfgfskasyrpynstpghvkisfggvcrniaenmarvgvntnfmsilgnde hgksivehskkigyhmddsmvieggstptylaildengemvsaiadmksigamntdfidskreifenae ytvldsdnpeimeyllknfkdktnfildpvsaekaswvkhlikdfhtikpnrheaeilagfpitdtddl ikasnyflglgikkvfisldadgifyndgvscgkikatevdvknvtgagdsfvaglgygymnkmpiedi vkfamtmsnitisheetihpdmaldtvlaklekttweeekydlnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.273
    Matthews' coefficent 2.10 Rfactor 0.231
    Waters 220 Solvent Content 41.48

    Ligand Information
    Ligands BGC (BETA-D-GLUCOSE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch